General Information

  • ID:  hor001947
  • Uniprot ID:  P01284
  • Protein name:  Vasoactive intestinal peptide
  • Gene name:  VIP
  • Organism:  Sus scrofa (Pig)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0032880 regulation of protein localization; GO:0045732 positive regulation of protein catabolic process; GO:0048255 mRNA stabilization; GO:0070459 prolactin secretion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSDAVFTDNYTRLRKQMAVKKYLNSILN
  • Length:  28(45-72)
  • Propeptide:  HADGVFTSDFSRLLGQLSAKKYLESLIXXXXXXXXXXXXXXXXXHSDAVFTDNYTRLRKQMAVKKYLNSILNGKR
  • Signal peptide:  NA
  • Modification:  T28 Asparagine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cause vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder.
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  VPAC1, VIPR2
  • Target Unid:  Q28992, A0A287AYV5
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: ~1 minute; /60 seconds ( PubMed ID: 730072 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001947_AF2.pdbhor001947_ESM.pdb

Physical Information

Mass: 380860 Formula: C147H237N43O43S
Absent amino acids: CEGPW Common amino acids: KLN
pI: 10.32 Basic residues: 6
Polar residues: 9 Hydrophobic residues: 9
Hydrophobicity: -63.93 Boman Index: -6956
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 83.57
Instability Index: 3188.21 Extinction Coefficient cystines: 2980
Absorbance 280nm: 110.37

Literature

  • PubMed ID:  2843830
  • Title:  Isolation and Characterization of a Variant Form of Vasoactive Intestinal Polypeptide.
  • PubMed ID:  4829446
  • Title:  Structure of the Porcine Vasoactive Intestinal Octacosapeptide. The Amino-Acid Sequence. Use of Kallikrein in Its Determination
  • PubMed ID:  730072
  • Title: